HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7V3

Names and origin
Entry : E1X7V3 (unreviewed)
Entry name : E1X7V3_HAEI1
Protein names : UPF0181 protein HIB_16400
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_16400
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0181 family
Protein sequence
Length : 56 residues
>E1X7V3|E1X7V3_HAEI1 Haemophilus influenzae 10810
MFDINLTHEQQQKAVEQIQELMAKGISSGEAIQIVAKALREIHKNDKKTPEN