HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7V2

Names and origin
Entry : E1X7V2 (unreviewed)
Entry name : E1X7V2_HAEI1
Protein names : Cold shock protein homolog
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_16390
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003677; GO:0005737; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm
General annotation
Domains : CSD (cold-shock) domain (1)
Subcellular location : Cytoplasm.
Protein sequence
Length : 80 residues
>E1X7V2|E1X7V2_HAEI1 Haemophilus influenzae 10810
MEIGIVKWFNNAKGFGFISAEGVDADIFAHYSVIEMDGYRSLKAGQKVQFEVLHSDKGSH
ATKIIPIADTQE