HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7V1

Names and origin
Entry : E1X7V1 (unreviewed)
Entry name : E1X7V1_HAEI1
Protein names : Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_16380
EC number : 4.2.-.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : aminoacyl-tRNA editing activity; cytoplasm; lyase activity; regulation of translational fidelity; translation
GO identifier : GO:0002161; GO:0005737; GO:0016829; GO:0006450; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Lyase; Protein biosynthesis
General annotation
Sequence similarities : Belongs to Prolyl-tRNA editing family, YbaK/EbsC subfamily
Subcellular location : Cytoplasm.
Protein sequence
Length : 170 residues
>E1X7V1|E1X7V1_HAEI1 Haemophilus influenzae 10810
MTPAIDLLKKQKIPFILHTYDHDPNNQHFGDEAAEKLGIDPNRSFKTLLVAENGDQKKLA
CFVLATANMLNLKKAAKSIGVKKVEMADKDAAQKSTGYLVGGISPLGQKKRVKTVINSTA
LEFETIYVSGGKRGLSVEIAPQDLAKVLGAEFTDIVDE