HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7K4

Names and origin
Entry : E1X7K4 (unreviewed)
Entry name : E1X7K4_HAEI1
Protein names : Sulfurtransferase (EC 2.8.1.-)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_15400
EC number : 2.8.1.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : transferase activity
GO identifier : GO:0016740
Keywords
Ligand & Biological process : Complete proteome; Transferase
General annotation
Sequence similarities : Belongs to DsrC/tusE family
Protein sequence
Length : 117 residues
>E1X7K4|E1X7K4_HAEI1 Haemophilus influenzae 10810
MLNINGIEVETDKDGYLLHSQQWNEDVARAIAQLESIELTDAHWEVIYFVRDFYQEYNTS
PAIRMLVKAMAEKLGADKGNSRYLQRLFPEGPAKQATKLAGLPKPAKCL