HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7K3

Names and origin
Entry : E1X7K3 (unreviewed)
Entry name : E1X7K3_HAEI1
Protein names : Probable molybdenum-pterin binding protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_15390
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : ATP binding; ATP-binding cassette (ABC) transporter complex; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; molybdenum ion binding
GO identifier : GO:0005524; GO:0043190; GO:0016820; GO:0030151
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 77 residues
>E1X7K3|E1X7K3_HAEI1 Haemophilus influenzae 10810
MKISARNQLKGKVVSIENGSVNAIVHIDIGGGNVLSSTVSLAAVKELNLEVGKEAYAIIK
ATSVMVGVE