HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7J9

Names and origin
Entry : E1X7J9 (unreviewed)
Entry name : E1X7J9_HAEI1
Protein names : FMN-dependent NADH-azoreductase (EC 1.7.-.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : azoR
ORF names : HIB_15350
EC number : 1.7.-.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : FMN binding; FMN reductase activity; electron carrier activity; oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor; oxidoreductase activity, acting on other nitrogenous compounds as donors
GO identifier : GO:0010181; GO:0008752; GO:0009055; GO:0016652; GO:0016661
Keywords
Ligand & Biological process : Complete proteome; FMN; Flavoprotein; NAD; Oxidoreductase
General annotation
Sequence similarities : Belongs to Azoreductase type 1 family
Protein sequence
Length : 210 residues
>E1X7J9|E1X7J9_HAEI1 Haemophilus influenzae 10810
MSNVLVLKSSISGNNSQTNQLADYVIEKLQGNNIVVRDLSQQPLPYFDTAAAIAVRGEPK
TTEEKQLLALSDKLIEELKNAQTLIIGAPMYNLNVPTQLKSYFDFIARPHVTFQYTANGP
EGLLKGKKAIVLCAFGGLYDEENLVTQYMKSILGFIGITDVQFVYAQGIGFGSEAIEKAQ
ASAKNKINEIVAAL