HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7I2

Names and origin
Entry : E1X7I2 (unreviewed)
Entry name : E1X7I2_HAEI1
Protein names : Conserved hypothetical DNA-binding ferritin-like protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_15180
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cellular iron ion homeostasis; ferric iron binding; oxidoreductase activity, oxidizing metal ions; response to stress
GO identifier : GO:0003677; GO:0006879; GO:0008199; GO:0016722; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; DNA-binding
General annotation
Sequence similarities : Belongs to Dps family
Protein sequence
Length : 172 residues
>E1X7I2|E1X7I2_HAEI1 Haemophilus influenzae 10810
MSKTSIGLDKVQSAELADKLNELLATYQVFYTNVRGYHWNIKGVNFFALHAKFEEIYTNL
VARVDEVAERILTLGYTPNNAYSQYLKISRIKEDIAVSEAQECLSGTLQGLKTLLDQQRE
ILAFANNANDEGTASQMSDYIKEQEKLVWMFQAACQTCHN