HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7F9

Names and origin
Entry : E1X7F9 (unreviewed)
Entry name : E1X7F9_HAEI1
Protein names : Transcription elongation factor GreA (Transcript cleavage factor GreA)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : greA
ORF names : HIB_14950
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; regulation of DNA-dependent transcription, elongation; transcription, DNA-dependent; translation elongation factor activity
GO identifier : GO:0003677; GO:0032784; GO:0006351; GO:0003746
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Elongation factor; Protein biosynthesis; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to GreA/GreB family
Protein sequence
Length : 170 residues
>E1X7F9|E1X7F9_HAEI1 Haemophilus influenzae 10810
MQQIPMTVRGAEQLREELDFLKNVRRPEIIKAIAEAREHGDLKENAEYHAAREQQGFCEG
RIQEIEAKLGNAQIIDVTKMPNNGKVIFGATVVLVNTNTDEEVTYRIVGDDEADIKSGLI
SVNSPIARGLIGKELDDTVNITTPGGVVEFDIIEVNYI