HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7F2

Names and origin
Entry : E1X7F2 (unreviewed)
Entry name : E1X7F2_HAEI1
Protein names : Macrodomain Ter protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : matP
ORF names : HIB_14880
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell cycle; cell division; cytoplasm; sequence-specific DNA binding
GO identifier : GO:0007049; GO:0051301; GO:0005737; GO:0043565
Keywords
Ligand & Biological process : Cell cycle; Cell division; Complete proteome; Cytoplasm; DNA-binding
General annotation
Sequence similarities : Belongs to MatP family
Subcellular location : Cytoplasm.
Protein sequence
Length : 160 residues
>E1X7F2|E1X7F2_HAEI1 Haemophilus influenzae 10810
MKYQKLENQEANWKWIYLIRKHREGENITRYEERSLQEAKAQELLESQNYPEKIEEWIKN
HLSPALPIKLDQAIRARRKRFFNGEKQHTKKKSIDLEYAVWLRLSKYSRKMKMTLSETIT
YMIDERESKAQFENQMAAMKTSLKNLLK