HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7D6

Names and origin
Entry : E1X7D6 (unreviewed)
Entry name : E1X7D6_HAEI1
Protein names : NAD-dependent protein deacylase (EC 3.5.1.-) (Regulatory protein SIR2 homolog)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : cobB
ORF names : HIB_14720
EC number : 3.5.1.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : NAD+ binding; NAD-dependent protein deacetylase activity; cytoplasm; peptidyl-lysine demalonylation; peptidyl-lysine desuccinylation; protein-malonyllysine demalonylase activity; protein-succinyllysine desuccinylase activity
GO identifier : GO:0070403; GO:0034979; GO:0005737; GO:0036047; GO:0036049; GO:0036054; GO:0036055
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Hydrolase; NAD
General annotation
Domains : Deacetylase sirtuin-type domain (1)
Sequence similarities : Belongs to Sirtuin family, Class III subfamily
Subcellular location : Cytoplasm.
Protein sequence
Length : 252 residues
>E1X7D6|E1X7D6_HAEI1 Haemophilus influenzae 10810
MTEKNKPICVVLTGAGISAESGIPTFRAEDGLWAGHKVEEVCTPEALQKNRAKVLDFYNQ
RRKNAAAAKPNAAHLALVELEKAYDVRIITQNVDDLHERAGSSKVLHLHGELNKARSSFD
ESYIVDCFGDQKLEDKDPNGHPMRPYIVFFGEMVPMLERAVDIVEQADVVLVIGTSLQVY
PANGLVNEAPRKAPIYLIDPNPNTGFVRKQVIAIKEKAGEGVPKVVAELLENTKNS