HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7C8

Names and origin
Entry : E1X7C8 (unreviewed)
Entry name : E1X7C8_HAEI1
Protein names : Predicted 2Fe-2S cluster-containing protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_14640
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding
GO identifier : GO:0051537; GO:0009055; GO:0046872
Keywords
Ligand & Biological process : 2Fe-2S; Complete proteome; Iron; Iron-sulfur; Metal-binding
General annotation
Domains : 2Fe-2S ferredoxin-type domain (1)
Protein sequence
Length : 90 residues
>E1X7C8|E1X7C8_HAEI1 Haemophilus influenzae 10810
MKIHLIRHNTTLEFNNETSLLDHLEKNNIHHEYQCRSGYCGSCRVKIKKGKVSYKEMPLA
FIQPDEILLCCCHVESDIEIDL