HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7C3

Names and origin
Entry : E1X7C3 (unreviewed)
Entry name : E1X7C3_HAEI1
Protein names : N utilization substance protein B homolog (Protein NusB)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : nusB
ORF names : HIB_14590
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA-dependent transcription, termination; RNA binding; regulation of transcription, DNA-dependent
GO identifier : GO:0006353; GO:0003723; GO:0006355
Keywords
Ligand & Biological process : Complete proteome; Transcription; Transcription regulation; Transcription termination
General annotation
Sequence similarities : Belongs to NusB family
Protein sequence
Length : 156 residues
>E1X7C3|E1X7C3_HAEI1 Haemophilus influenzae 10810
MTEQKQVKKPSARRRARECTVQALYSWAVSGNTAEQVELAFVLDQDMEGVDKPYFRKLFR
QTIENIETVDFSISPYIDRAFDELDPIETAILRLAVYELRFELDVPYKVVINEAIEVAKV
FGADESHKYINGVLDKIAPALGRK