HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X7A8

Names and origin
Entry : E1X7A8 (unreviewed)
Entry name : E1X7A8_HAEI1
Protein names : Ribosome-binding factor A
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rbfA
ORF names : HIB_14440
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; rRNA processing
GO identifier : GO:0005737; GO:0006364
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; rRNA processing
General annotation
Sequence similarities : Belongs to RbfA family
Subcellular location : Cytoplasm.
Protein sequence
Length : 140 residues
>E1X7A8|E1X7A8_HAEI1 Haemophilus influenzae 10810
MAREFKRSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHD
ETAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGMRMSNLVTNVVREDE
KKHVEESN