HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X797

Names and origin
Entry : E1X797 (unreviewed)
Entry name : E1X797_HAEI1
Protein names : Ribosome maturation factor RimP
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rimP
ORF names : HIB_14330
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; ribosome biogenesis
GO identifier : GO:0005737; GO:0042254
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Ribosome biogenesis
General annotation
Sequence similarities : Belongs to RimP family
Subcellular location : Cytoplasm.
Protein sequence
Length : 163 residues
>E1X797|E1X797_HAEI1 Haemophilus influenzae 10810
MATLEQNLQEMLQDAVKDLGCELWGIECQRVGRFMTVRLFIDKEGGVTVDDCADVSRQVS
AILDVEDPIADKYNLEVSSPGLDRPLFTLPQFERYIGQDIAVHLRIPVMERRKWQGKLER
IEKDMITLIVDDQEQILVFGNIQKANVVAKF