HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X772

Names and origin
Entry : E1X772 (unreviewed)
Entry name : E1X772_HAEI1
Protein names : Predicted DNA-binding transcriptional regulator
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_14080
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : sequence-specific DNA binding
GO identifier : GO:0043565
Keywords
Ligand & Biological process : Complete proteome; DNA-binding
Protein sequence
Length : 115 residues
>E1X772|E1X772_HAEI1 Haemophilus influenzae 10810
MMTRKPTSVGEILQEEFLEPLSLKISDLAQILDVHRNTASNIVNNSSRITLEMAVKLAKV
FDTTPEFWLNLQTRIDLWDLEHNKRFQQSLANVKPALHRHDTSTFAM