HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X743

Names and origin
Entry : E1X743 (unreviewed)
Entry name : E1X743_HAEI1
Protein names : Integration host factor subunit beta (IHF-beta)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : himD
ORF names : ihfB
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; DNA recombination; chromosome; regulation of transcription, DNA-dependent; regulation of translation; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0006310; GO:0005694; GO:0006355; GO:0006417; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA recombination; DNA-binding; Transcription; Transcription regulation; Translation regulation
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Protein sequence
Length : 102 residues
>E1X743|E1X743_HAEI1 Haemophilus influenzae 10810
MTKSELMEKLSAKQPTLPAKEIENMVKDILEFISQSLENGDRVEVRGFGSFSLHHRQPRL
GRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA