HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X727

Names and origin
Entry : E1X727 (unreviewed)
Entry name : E1X727_HAEI1
Protein names : UPF0208 membrane protein HIB_13630
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_13630
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane
GO identifier : GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to UPF0208 family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 159 residues
>E1X727|E1X727_HAEI1 Haemophilus influenzae 10810
MAFFSIFKQGQIYLNTWPLEAKLGIIFPENRIMKATSFAQKFMPFVAVFAILWQQFYAKN
DLMAFSIAILTALFALLIPFQGLYWLGKRANTPLENQSAVWFYDICERLKQLHEPLPFVQ
EKPTYQHLAEVLKKAQSKFERAFWQEI