HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X709

Names and origin
Entry : E1X709 (unreviewed)
Entry name : E1X709_HAEI1
Protein names : 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_13450
EC number : 4.-.-.-
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : lyase activity; metal ion binding; queuosine biosynthetic process
GO identifier : GO:0016829; GO:0046872; GO:0008616
Keywords
Ligand & Biological process : Complete proteome; Lyase; Metal-binding; Queuosine biosynthesis; Zinc
General annotation
Pathway : Purine metabolism; 7-cyano-7-deazaguanine biosynthesis.
Sequence similarities : Belongs to PTPS family, QueD subfamily
Protein sequence
Length : 153 residues
>E1X709|E1X709_HAEI1 Haemophilus influenzae 10810
MFKISKEFSFDMAHLLDGHDGKCQNLHGHTYKLQVEISGDLYESGAKKAMVIDFSDLKSI
VKKVILDPMDHAFIYDQTNERESQIATLLQKLNSKTFGVPFRTTAEEIARFIFNRLKHDE
QLSISSIRLWETPTSFCEYQE