HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6Z4

Names and origin
Entry : E1X6Z4 (unreviewed)
Entry name : E1X6Z4_HAEI1
Protein names : Protein SprT
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : sprT
ORF names : HIB_13300
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; zinc ion binding
GO identifier : GO:0005737; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Metal-binding; Zinc
General annotation
Domains : SprT-like domain (1)
Sequence similarities : Belongs to SprT family
Subcellular location : Cytoplasm.
Protein sequence
Length : 183 residues
>E1X6Z4|E1X6Z4_HAEI1 Haemophilus influenzae 10810
MTSISLIPFRHLKMQVQRKLNQSLQLAEAYFKRKFTMPEVNYELRGIKAGVAYLQKNEIK
FNRTLLQENTDEFIRQVVPHELAHLIVYQMFGRVKPHGKEWQLVMNEIFKLPADTCHQFD
IKNVQGKTFEYRCACQTHFLTIRRHNKIMKENIEYLCKKCKGKLVFVDDEE