HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6Y6

Names and origin
Entry : E1X6Y6 (unreviewed)
Entry name : E1X6Y6_HAEI1
Protein names : Glutaredoxin
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_13220
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0009055; GO:0015035
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to Glutaredoxin family, Monothiol subfamily
Protein sequence
Length : 128 residues
>E1X6Y6|E1X6Y6_HAEI1 Haemophilus influenzae 10810
MIKCLPRLFIGNIMETLDKIKKQISENPILIYMKGSPKLPSCGFSARASEALMHCKVPFG
YVDILQHPDIRAELPTYANWPTFPQLWVEGELIGGCDIILEMYQAGELQTLLAEVAAKHA