HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6X7

Names and origin
Entry : E1X6X7 (unreviewed)
Entry name : E1X6X7_HAEI1
Protein names : Anaerobic ribonucleoside-triphosphate reductase-activating protein (EC 1.97.1.-)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_13130
EC number : 1.97.1.-
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 4 iron, 4 sulfur cluster binding; [formate-C-acetyltransferase]-activating enzyme activity; cytoplasm
GO identifier : GO:0051539; GO:0043365; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Oxidoreductase
General annotation
Sequence similarities : Belongs to Organic radical-activating enzymes family
Protein sequence
Length : 167 residues
>E1X6X7|E1X6X7_HAEI1 Haemophilus influenzae 10810
MNYLQYYPTDVINGEGTRCTLFVSGCTHACKGCYNQKSWSFSAGVLFDEAMEQQIINDLK
DTRIKRQGLTLSGGDPLHPRNVETLLPFVQRVKRECPDKDIWVWTGYKLDELDEQQRAML
PYIDVLIDGKFIQEQADPSLVWRGSANQIIHRFKL