HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6R4

Names and origin
Entry : E1X6R4 (unreviewed)
Entry name : E1X6R4_HAEI1
Protein names : Cytochrome c biogenesis protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_12500
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cytochrome complex assembly; heme transport; integral to membrane
GO identifier : GO:0017004; GO:0015886; GO:0016021
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 75 residues
>E1X6R4|E1X6R4_HAEI1 Haemophilus influenzae 10810
MFFQTWSDFFNMGGYGFYVWLSYAVSLVAVIALIVQSVKQRKTVLQNVLREQQREERLQQ
ANKGNTL