HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6R1

Names and origin
Entry : E1X6R1 (unreviewed)
Entry name : E1X6R1_HAEI1
Protein names : Heme exporter subunit
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_12470
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; ATP catabolic process; ATPase activity; cytochrome complex assembly; outer membrane-bounded periplasmic space; plasma membrane; transporter activity
GO identifier : GO:0005524; GO:0006200; GO:0016887; GO:0017004; GO:0030288; GO:0005886; GO:0005215
Keywords
Ligand & Biological process : ATP-binding; Cell membrane; Complete proteome; Cytochrome c-type biogenesis; Hydrolase; Membrane; Nucleotide-binding; Transport
General annotation
Sequence similarities : Belongs to ABC transporter superfamily
Protein sequence
Length : 228 residues
>E1X6R1|E1X6R1_HAEI1 Haemophilus influenzae 10810
MFEQHKLSLQNLSCQRGERVLFRALTCDFNSGDFVQIEGHNGIGKTSLLRILAGLAQSLE
GEVRWDAEAISKQREQYHQNLLYLGHLLGVKPELTAWENLQFYQRISQAEQNTDMLWDLL
EKVGLLGREDLPAAQLSAGQQKRIALGRLWLSQAPLWILDEPFTAIDKKGVKILTALFDE
HAQRGGIVLLTSHQEVPSSHLQKLNLAAYKAE