HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6M9

Names and origin
Entry : E1X6M9 (unreviewed)
Entry name : E1X6M9_HAEI1
Protein names : Conserved putative gamma-carboxymuconolactone decarboxylase subunit
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_12140
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : peroxidase activity; peroxiredoxin activity
GO identifier : GO:0004601; GO:0051920
Keywords
Ligand & Biological process : Antioxidant; Complete proteome; Disulfide bond; Oxidoreductase; Peroxidase; Redox-active center
Protein sequence
Length : 121 residues
>E1X6M9|E1X6M9_HAEI1 Haemophilus influenzae 10810
MFTDWKEHTSHVKKSFGELGKQHPKMLQAYQALGAAAAEGNVLDAKTRELIALAVAVTTR
CESCISVHAEEAVKAGASEAEVAAALATAIALNAGAAYTYSLRALEAYSVQKA