HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6M6

Names and origin
Entry : E1X6M6 (unreviewed)
Entry name : E1X6M6_HAEI1
Protein names : Predicted copper chaperone MerP homolog
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_12110
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : metal ion binding; metal ion transport
GO identifier : GO:0046872; GO:0030001
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 100 residues
>E1X6M6|E1X6M6_HAEI1 Haemophilus influenzae 10810
MKKLCTALLLSLFAISFAHANETKQIVLKVKEMNCQLCAYLVNKELRNIDGVILTKASIK
DGLVTVVEDPKVTNQQLFDAIHKLKYTAEVVN