HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6M5

Names and origin
Entry : E1X6M5 (unreviewed)
Entry name : E1X6M5_HAEI1
Protein names : Putative mercuric transport protein MerT homolog
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_12100
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : membrane; mercury ion transmembrane transporter activity
GO identifier : GO:0016020; GO:0015097
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 128 residues
>E1X6M5|E1X6M5_HAEI1 Haemophilus influenzae 10810
MTTYLKNSNKSFWVAIATALSAAVASTLCCIAPLIYLVFGVSSTWLIGLGEYDYLRIPML
IISLCAFAYGFWLLMFSKKIICSKYISRKKLIVLYWIVFIVMIFFLTYPTILPWILELAN