HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6H8

Names and origin
Entry : E1X6H8 (unreviewed)
Entry name : E1X6H8_HAEI1
Protein names : Genome
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_11630
ORF names : HIB_11780
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : DNA integration; nucleic acid binding
GO identifier : GO:0015074; GO:0003676
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 87 residues
>E1X6H8|E1X6H8_HAEI1 Haemophilus influenzae 10810
MLEGKAVQSMSRRGNCYDNAVIESFFAILKSECFYSRTYHSIAELQAEIEEYLVYYNQKR
IKLGLKGLSPVQYRAQYLS