HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6F4

Names and origin
Entry : E1X6F4 (unreviewed)
Entry name : E1X6F4_HAEI1
Protein names : Genome
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_11390
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane
GO identifier : GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Membrane
Protein sequence
Length : 57 residues
>E1X6F4|E1X6F4_HAEI1 Haemophilus influenzae 10810
MPTCSCYGIEALKTHGLLKGGWLTLKRVLKCHPLNAGGFDPVPPKTNNNDEKK