HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6F3

Names and origin
Entry : E1X6F3 (unreviewed)
Entry name : E1X6F3_HAEI1
Protein names : Genome
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_11380
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : nucleic acid phosphodiester bond hydrolysis; ribonuclease P activity; tRNA binding; tRNA processing
GO identifier : GO:0090305; GO:0004526; GO:0000049; GO:0008033
Keywords
Ligand & Biological process : Complete proteome; Endonuclease; Hydrolase; Nuclease; RNA-binding; tRNA processing
Protein sequence
Length : 79 residues
>E1X6F3|E1X6F3_HAEI1 Haemophilus influenzae 10810
MTVAKKHLKRAHERNRIKRLVRESFRLSQHCLPAYDFVFVAKNGIGKLDNSTFAQILEKL
WQRHIRLAQKS