HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6F2

Names and origin
Entry : E1X6F2 (unreviewed)
Entry name : E1X6F2_HAEI1
Protein names : 50S ribosomal protein L34
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rpmH
ORF names : HIB_11370
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L34P family
Protein sequence
Length : 48 residues
>E1X6F2|E1X6F2_HAEI1 Haemophilus influenzae 10810
MKRTFQPSVLKRSRTHGFRARMATKNGRQVLARRRAKGRKSLSA