HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6B9

Names and origin
Entry : E1X6B9 (unreviewed)
Entry name : E1X6B9_HAEI1
Protein names : 30S ribosomal protein S20
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rpsT
ORF names : HIB_11040
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S20P family
Protein sequence
Length : 95 residues
>E1X6B9|E1X6B9_HAEI1 Haemophilus influenzae 10810
MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAAGEKSAAEAAFVEMQKVVDR
MASKGLIHANKAANHKSKLAAQIKKLA