HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6A9

Names and origin
Entry : E1X6A9 (unreviewed)
Entry name : E1X6A9_HAEI1
Protein names : Nucleoid occlusion factor SlmA
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : slmA
ORF names : HIB_10940
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : bacterial nucleoid; cell cycle; cell division; cytoplasm; negative regulation of barrier septum assembly; sequence-specific DNA binding
GO identifier : GO:0043590; GO:0007049; GO:0051301; GO:0005737; GO:0010974; GO:0043565
Keywords
Ligand & Biological process : Cell cycle; Cell division; Complete proteome; Cytoplasm; DNA-binding
General annotation
Domains : HTH tetR-type DNA-binding domain (1)
Sequence similarities : Belongs to Nucleoid occlusion factor SlmA family
Subcellular location : Cytoplasm › nucleoid.
Protein sequence
Length : 234 residues
>E1X6A9|E1X6A9_HAEI1 Haemophilus influenzae 10810
MVEEQLSLSGVEEIAPKIETPKIEKRTVKERRQQVLTVLIHMLHSERGMERMTTARLAKE
VGVSEAALYRYFPSKTKMFEALIEHIESTLLSRITASMRNETQTMNRIHDILQTILDFAR
KNPGLTRVLTGHALMFEEAQLQARVAQFFDRLEMQFVNILQMRKLREGRAFNVDERIIAS
HLVTLCEGQFMRYVRTNFRLNSSQSFEQQWRFIEPLFA