HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6A4

Names and origin
Entry : E1X6A4 (unreviewed)
Entry name : E1X6A4_HAEI1
Protein names : 50S ribosomal protein L33
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rpmG
ORF names : HIB_10890
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L33P family
Protein sequence
Length : 60 residues
>E1X6A4|E1X6A4_HAEI1 Haemophilus influenzae 10810
MAAKGAREKIRLVSTAETGHFYTTDKNKRNMPEKMEIKKFDPVVRKHVIYKEAKIK