HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1X6A1

Names and origin
Entry : E1X6A1 (unreviewed)
Entry name : E1X6A1_HAEI1
Protein names : Probable ribonuclease VapC (Probable RNase VapC) (EC 3.1.-.-) (Toxin VapC)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : vapC
ORF names : HIB_10860
EC number : 3.1.-.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : magnesium ion binding; nucleic acid phosphodiester bond hydrolysis; ribonuclease activity
GO identifier : GO:0000287; GO:0090305; GO:0004540
Keywords
Ligand & Biological process : Complete proteome; Hydrolase; Magnesium; Metal-binding; Nuclease; Toxin
General annotation
Sequence similarities : Belongs to PINc/VapC protein family
Protein sequence
Length : 144 residues
>E1X6A1|E1X6A1_HAEI1 Haemophilus influenzae 10810
MLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVI
EDFLSRLTILDYQPKHAAHFGNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREF
ERVIALRTENWV