HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UIZ5

Names and origin
Entry : A5UIZ5 (reviewed)
Entry name : RL25_HAEIG
Protein names : 50S ribosomal protein L25
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : rplY
ORF names : CGSHiGG_09940
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 5S rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0008097; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L25P family
Reference
PubMed ID : 17550610
Protein sequence
Length : 103 residues
>A5UIZ5|RL25_HAEIG Haemophilus influenzae PittGG
MAFKFNAEVRTAQGKGASRRLRHNGQIPAIVYGGSEEPVSIILNHDELNNAQAHESFYSE
VITLVIGGKEVAVKVQAMQRHPFKPKLVHIDFKRA