HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UIV6

Names and origin
Entry : A5UIV6 (unreviewed)
Entry name : A5UIV6_HAEIG
Protein names : DNA-dependent helicase II
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : uvrD
ORF names : CGSHiGG_09670
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : helicase activity
GO identifier : GO:0004386
Keywords
Ligand & Biological process : ATP-binding; Complete proteome; Helicase; Hydrolase; Nucleotide-binding
Reference
PubMed ID : 17550610
Protein sequence
Length : 51 residues
>A5UIV6|A5UIV6_HAEIG Haemophilus influenzae PittGG
MKKWLLIIAGALIISACANKDVYFNGAEGSHSGVKFDKDSRQWGLNQ