HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UIT4

Names and origin
Entry : A5UIT4 (unreviewed)
Entry name : A5UIT4_HAEIG
Protein names : Glutaredoxin
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : hemH
ORF names : CGSHiGG_09520
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; electron carrier activity; lyase activity; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0009055; GO:0016829; GO:0015035
Keywords
Ligand & Biological process : Complete proteome; Lyase
General annotation
Sequence similarities : Belongs to Glutaredoxin family, Monothiol subfamily
Reference
PubMed ID : 17550610
Protein sequence
Length : 115 residues
>A5UIT4|A5UIT4_HAEIG Haemophilus influenzae PittGG
METLDKIKKQISENPILIYMKGSPKLPSCGFSARASEALMHCKVPFGYVDILQHPDIRAE
LPTYANWPTFPQLWVEGELIGGCDIILEMYQAGELQTLLAEVAAKHA