HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UIQ4

Names and origin
Entry : A5UIQ4 (unreviewed)
Entry name : A5UIQ4_HAEIG
Protein names : S-adenosyl-methyltransferase
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_09310
History
Date of creation : 2007-07-10
Date of modification : 2013-05-29
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : methyltransferase activity
GO identifier : GO:0008168
Keywords
Ligand & Biological process : Complete proteome; Methyltransferase; Transferase
Reference
PubMed ID : 17550610
Protein sequence
Length : 47 residues
>A5UIQ4|A5UIQ4_HAEIG Haemophilus influenzae PittGG
MREDQIQRNQKLRIIGKAIQPSDAEIQVNPRSRSAILRVAERI