HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UIH1

Names and origin
Entry : A5UIH1 (unreviewed)
Entry name : A5UIH1_HAEIG
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_08845
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : homocysteine S-methyltransferase activity
GO identifier : GO:0008898
Keywords
Ligand & Biological process : Complete proteome
Reference
PubMed ID : 17550610
Protein sequence
Length : 37 residues
>A5UIH1|A5UIH1_HAEIG Haemophilus influenzae PittGG
MVNKTAQLKQALENRILILDGAMGTMIQKYKLT