HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UID4

Names and origin
Entry : A5UID4 (reviewed)
Entry name : YIDD_HAEIG
Protein names : Putative membrane protein insertion efficiency factor
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_08600
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane
GO identifier : GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane
General annotation
Sequence similarities : Belongs to UPF0161 family
Subcellular location : Cell inner membrane; Peripheral membrane protein; Cytoplasmic side.
Reference
PubMed ID : 17550610
Protein sequence
Length : 94 residues
>A5UID4|YIDD_HAEIG Haemophilus influenzae PittGG
MAETHSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKR
VLKCHPLNAGGFDPVPPKTNNNDEKK