HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UIA9

Names and origin
Entry : A5UIA9 (unreviewed)
Entry name : A5UIA9_HAEIG
Protein names : 30S ribosomal protein S20
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : rpsT
ORF names : CGSHiGG_08415
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : ribosome
GO identifier : GO:0005840
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
Reference
PubMed ID : 17550610
Protein sequence
Length : 38 residues
>A5UIA9|A5UIA9_HAEIG Haemophilus influenzae PittGG
MQNSSNIFTTDKAANEFSFPDLKNFRYNDRTFLR