HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UI84

Names and origin
Entry : A5UI84 (unreviewed)
Entry name : A5UI84_HAEIG
Protein names : Transcriptional repressor NrdR
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : nrdR
ORF names : CGSHiGG_08280
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; DNA binding; negative regulation of transcription, DNA-dependent; transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0005524; GO:0003677; GO:0045892; GO:0006351; GO:0008270
Keywords
Ligand & Biological process : ATP-binding; Complete proteome; DNA-binding; Metal-binding; Nucleotide-binding; Repressor; Transcription; Transcription regulation; Zinc; Zinc-finger
General annotation
Domains : ATP-cone domain (1)
Sequence similarities : Belongs to NrdR family
Reference
PubMed ID : 17550610
Protein sequence
Length : 128 residues
>A5UI84|A5UI84_HAEIG Haemophilus influenzae PittGG
MHCPFCDTEETKVIDSRLVSDGYQVRRRRECGHCHERFTTFEMAELIIPKIIKTDGTREP
FNEDKLRSGIQHALEKRPVSADDVEKAINHIILQLRATGEREVPSKLVGKLAMNELKKTR