HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UI24

Names and origin
Entry : A5UI24 (reviewed)
Entry name : RL27_HAEIG
Protein names : 50S ribosomal protein L27
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : rpmA
ORF names : CGSHiGG_07940
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L27P family
Reference
PubMed ID : 17550610
Protein sequence
Length : 93 residues
>A5UI24|RL27_HAEIG Haemophilus influenzae PittGG
MATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGNNVGMGRDHTLF
ATADGKVKFEVKGEKSRKYVSIVTE