HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UHW5

Names and origin
Entry : A5UHW5 (reviewed)
Entry name : CSRA_HAEIG
Protein names : Carbon storage regulator homolog
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : csrA
ORF names : CGSHiGG_07560
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; mRNA catabolic process; regulation of carbohydrate metabolic process
GO identifier : GO:0003723; GO:0006402; GO:0006109
Keywords
Ligand & Biological process : Complete proteome; RNA-binding
General annotation
Sequence similarities : Belongs to CsrA family
Reference
PubMed ID : 17550610
Protein sequence
Length : 71 residues
>A5UHW5|CSRA_HAEIG Haemophilus influenzae PittGG
MLILTRKVGESVLIGDDISITVLSVRGNQVKLGVEAPKEVSVHREEIYQRIKQTKDEPYL
GSS