HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UHT8

Names and origin
Entry : A5UHT8 (reviewed)
Entry name : RL29_HAEIG
Protein names : 50S ribosomal protein L29
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : rpmC
ORF names : CGSHiGG_07425
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L29P family
Reference
PubMed ID : 17550610
Protein sequence
Length : 71 residues
>A5UHT8|RL29_HAEIG Haemophilus influenzae PittGG
MKAQDLRTKSVEELNAELVNLLGEQFKLRMQTATGQLQQTHQAKQVRRDIARVKTVLTEK
AGE