HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UHT5

Names and origin
Entry : A5UHT5 (reviewed)
Entry name : RL22_HAEIG
Protein names : 50S ribosomal protein L22
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : rplV
ORF names : CGSHiGG_07410
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : large ribosomal subunit; rRNA binding; structural constituent of ribosome; translation
GO identifier : GO:0015934; GO:0019843; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L22P family
Reference
PubMed ID : 17550610
Protein sequence
Length : 118 residues
>A5UHT5|RL22_HAEIG Haemophilus influenzae PittGG
METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR