HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UHT2

Names and origin
Entry : A5UHT2 (reviewed)
Entry name : RL23_HAEIG
Protein names : 50S ribosomal protein L23
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : rplW
ORF names : CGSHiGG_07395
History
Date of creation : 2008-02-05
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : nucleotide binding; rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0000166; GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L23P family
Reference
PubMed ID : 17550610
Protein sequence
Length : 107 residues
>A5UHT2|RL23_HAEIG Haemophilus influenzae PittGG
MSQERLLSVLRAPHISEKATNNAEKSNTVVLKVALDANKAEIAAAVAQLFEVKVDSVRTV
VVKGKTKRRGNKMGRRSDWKKAYVTLAEGQNLDFVDSAE