HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UHK3

Names and origin
Entry : A5UHK3 (reviewed)
Entry name : TUSA_HAEIG
Protein names : Sulfurtransferase TusA homolog (EC 2.8.1.-)
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : tusA
ORF names : CGSHiGG_06920
EC number : 2.8.1.-
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; sulfurtransferase activity
GO identifier : GO:0005737; GO:0016783
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Transferase
General annotation
Sequence similarities : Belongs to UPF0033 family, TusA subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 87 residues
>A5UHK3|TUSA_HAEIG Haemophilus influenzae PittGG
MSEISVTQTLNTLGLRCPEPVMLVRKNIRHLNDGEILLIIADDPATTRDIPSFCQFMDHT
LLQSEVEKPPFKYWVKRGK