HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UHJ8

Names and origin
Entry : A5UHJ8 (unreviewed)
Entry name : A5UHJ8_HAEIG
Protein names : Protein translocase subunit SecE
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : clpX
ORF names : secE
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; P-P-bond-hydrolysis-driven protein transmembrane transporter activity; integral to membrane; intracellular protein transmembrane transport; peptidase activity; plasma membrane; protein secretion; protein targeting; protein transport by the Se
GO identifier : GO:0005524; GO:0015450; GO:0016021; GO:0065002; GO:0008233; GO:0005886; GO:0009306; GO:0006605; GO:0043952; GO:0006508
Keywords
Ligand & Biological process : ATP-binding; Cell inner membrane; Cell membrane; Complete proteome; Hydrolase; Membrane; Nucleotide-binding; Protease; Protein transport; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to SecE/SEC61-gamma family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 150 residues
>A5UHJ8|A5UHJ8_HAEIG Haemophilus influenzae PittGG
MATEIVDKKKNTQEVIVEGKSKGLNTFLWVLAVIFFAAAAIGNIYFQQIYSLPIRVIGMA
IALVIAFILAAITNQGTKARAFFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFW
AVDSIIVTVINFLTDLRF