HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UHC3

Names and origin
Entry : A5UHC3 (unreviewed)
Entry name : A5UHC3_HAEIG
Protein names : Elongation factor G
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_06420
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : translation elongation factor activity
GO identifier : GO:0003746
Keywords
Ligand & Biological process : Complete proteome; Elongation factor; Protein biosynthesis
Reference
PubMed ID : 17550610
Protein sequence
Length : 62 residues
>A5UHC3|A5UHC3_HAEIG Haemophilus influenzae PittGG
MTGAQPVLIWLLISSIIASIISHQFSPKPFYHFAAGCFRQQMQARQAEELRSKTEQEK